MergeAlign

Alignment:

You need Javascript enabled to see the output

MergeAlign has created a consensus alignment with a mean column score of 21%.

Use the slider below to filter out poor scoring columns.

100 columns (100%) are present in at least 1 of the original 100 alignments.
CLUSTAL
FASTA
Column scores
SVG Image



    

N.B. The threshold slider has no effect on this image.

If you can't see the image then you need to use a different browser such as Chrome or Firefox.

0 10 20 30 40 50 60 70 80 90 100 -----------------NMMELAEI---DTMI-PFDLSATKKNTMEMYRVRLSDKPHTDDPILCL--SLSPAS---DPRL 54 RWPEYLRDSEANPVDQPTEPDVAAC--------RF---------------YTLDTVSWTKESRGW--WWKLPD----ALR 51 SSTNEIETNEGLAGTSLDVMDLSRVLSIPNYWDRF----------TWKTSDVINTVLWDNYVSPF--KVKPYSATITDRF 68 TDATA-DFVAQPVYLPENQTKVAFFYDRSSPIGRF---AVKSGSLESGFAPFSNKACPNSVILTPGPQFDPAYDQLRPQR 76 YGYATAEDFVSGPNTSGLETRVVQAE-------RF------------FKTHLFDWVTSDSFGRCH--LLELPT------D 53 YGKVFNPPRNQLPGRFTNLLDVAEA--CPTFL-RF----------EGGVPYVTTKTDSDRVLAQF--DMSLAA----KHM 61 VTTTVENYGGETQIQRRQHTDVSFIMD------RF-----------------VKVTPQNQINILD--LMQVPS------- 48 PSDTVQ-TRHVVQHRSRSESSIESFFARGACVTIM------------TVDNPASTTNKDKLFAVW--KITYKD------- 58 * * * * * SHTMLGE--------------------ILNYYTHWAGSLKFTFLFCGSMMATGK-------LLVSYAPPGADPPKKRK-- 105 DMGLFGQ--------------------NMYYHYLGRSGYTVHVQCNASKFHQGA-------LGVFAVPEMCLAGDSNTTT 104 RCTHMGK--------------------VANAFTYWRGSMVYTFKFVKTQYHSGR-------LRISFIPYYYNTTISTGTP 121 LTEIWGNGNEETSEVFPLKTKQDYSFCLFSPFVYYKCDLEVTLSPHTSGAHG---------LLVRWCPTGTP--TKPTTQ 145 HKGVYGS--------------------LTDSYAYMRNGWDVEVTAVGNQFNGGC-------LLVAMVPELCSIQKR---- 102 SNTFLAG--------------------LAQYYTQYSGTINLHFMFTGPTDAKAR-------YMVAYAPPGMEPPKTPE-- 112 -HTLVGG--------------------LLRASTYYFSDLEIAVKHEGD---------------LTWVPNGA--PEK---- 86 -TVQLRR--------------------KLEFFTYSRFDMELTFVVTANFTETNNGHALNQVYQIMYIPPGAPVPEKWD-- 115 ------------------------------------------------EAMLGTHVIWDIGLQSSC-------TMVVPWI 130 MHTSYQNANPGEKGGTFTGTFTPDNNQTSPARRFCPVDYLLGNGTLLGNAFVFPHQIINLRTNNCA-------TLVLPYV 177 ------------------------------------------------DVSRTQKIVVDLRTSTAV-------SFTVPYI 146 ---------------------------------------VLHEVSSLSEGRTPQVYSAGPGTSNQI-------SFVVPYN 179 ---------------------------------------------ELYQLTLFPHQFINPRTNMTA-------HITVPFV 130 ------------------------------------------------AAAHCIHAEWDTGLNSKF-------TFSIPYL 137 --------------------------------------------------------ALDNTTNPTAYHKAPLTRLALPYT 110 --------------------------------------------DYTWQTSSNPSIFYTYGTAPA--------RISVPYV 143 SNTTYRQTIDDSFTE---------------GGYISVFYQTRIVVPLSTPREMD---ILGFVSACNDFSVRLLRDTTH- 191 NSLSIDSMVKHNNWG----------------------IAILPLAPLNFASESSPEIPITLTIAPMCCEFNGLRNITL- 234 GSRPWLYCIRPESSWLSKDNTDGALMYNCVSGIVRVEVLNQLVAAQNVFSEID---VICEVNGGPDLEFAGPTCPRY- 222 SPLSVLPAVWYNGHK--RFDNTGDL-----GIAPNSDFGTLFFA------GTKPDIKFTVYLRYKNMRVFCPRPTVFF 246 GVNRYDQYKVHKPWT----------------------LVVMVVAPLTVNTEGAPQIKVYANIAPTNVHVAGEFPSKE- 187 SAADYTYTASDVAET--------------------TNVQGWVCLFQITHGKADGDALVVLASAGKDFELRLPVDARA- 196 APHRVLATVYNGECR--------------------------TLPTSFNYGAIKATRVTELLYRMKRAETYCPRPLLAI 164 GISNAYSHFYDGFSKVPLKDQSAALGDSLYGAASLNDFGILAVRVVNDHNPTKVTSKIRVYLKPKHIRVWCPRPPRAV 223 1al2_ad 1al2_ac 1b35_C 1mec_aa 1bbt_ab 1bbt_ac 1bbt_aa 1al2_ab Column support (%): * columns present in 100% of constituent alignments

References

If you use MergeAlign please cite:

1. Collingridge PW & Kelly S (BMC Bioinformatics 2012, 13:117)
MergeAlign: improving multiple sequence alignment performance by dynamic reconstruction of consensus multiple sequence alignments.